• Account
  • Account
    Inquiries
    0

    Inquired items

    0 items total Subtotal:$ 0
  • 会员中心
    Cart

    Added items

    0items total Subtotal:$ 0

All Departments

Aquaporin 4 (249-323) Antibody

Catalog # Availability Size / Price Inquiry
APR15002G 50 μl / $695

Aquaporin 4 (249-323) Antibody

Brand

Leading Biology

Catalog Number

APR15002G

Product Type

Polyclonal Antibodies

Field of Research

Product Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Aquaporin 4 (249-323) antibody.

Molecular Weight

34480 Da

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Target

GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSK AAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGK DSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4 (Accession # P47863). Intracellular, C-terminus.

GeneID

UniProt ID

Summary

Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belongs to the first group.1Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores.1AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance.2In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-4.3

Form

Affinity purified antibody, Liquid

Storage & Stability

Store at +4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Applications

WB

Dilution

WB~~1:200-1:2000

Synonyms

Aquaporin-4, AQP-4, Mercurial-insensitive water channel, MIWC, WCH4, Aqp4

Images

Western blot analysis of rat brain membranes: 1. Anti-Aquaporin 4 (249-323) antibody ( APR15002G), (1:1000). 2. Anti-Aquaporin 4 (249-323) antibody, preincubated with the control fusion protein.

Specification

Quantity

Related Products

Select Brand Catalog No. Product Name Pack Size Type Field of Research Specification Quantity Price(USD)
1 Leading Biology APR03440G ITGA11 Antibody (N-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
2 Leading Biology APR04537G CMIP Antibody (C-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
3 Leading Biology APR12422G Human H4 Histamine Receptor (extracellular) Antibody 50 μl Polyclonal Antibodies
$695.00 Add Ask
4 Leading Biology APR03844G UBE2W Antibody (C-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
5 Leading Biology APR04349G HECTD2 Antibody (N-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
6 Leading Biology APR03502G IGHG1 Antibody (Center) 100 μl Polyclonal Antibodies
$495.00 Add Ask

Contact Us

This item has successfully been added to your cart!

You have 0 item in your cart

Your inquiry has successfully been added to your list!

You have 0 item in your inquiry list