• Account
  • Account
    Inquiries
    0

    Inquired items

    0 items total Subtotal:$ 0
  • 会员中心
    Cart

    Added items

    0items total Subtotal:$ 0

All Departments

Kir3.1 (GIRK1) Antibody

Catalog # Availability Size / Price Inquiry
AMM06205G 50 μl / $695

Kir3.1 (GIRK1) Antibody

Brand

Leading Biology

Catalog Number

AMM06205G

Product Type

Polyclonal Antibodies

Field of Research

Product Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Kir3.1 (GIRK1) antibody.

Molecular Weight

56573 Da

Host

Rabbit

Species Reactivity

Mouse, Rat

Target

GST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 of mouse GIRK1? (Accession P63250), (MW: 34 kDa.).?Intracellular, C-terminus.

GeneID

UniProt ID

Summary

Kir3.1 (or G-protein regulated Inward-Rectifier K+ channel, GIRK1) is a member of the family of inward rectifying K+ channels. The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels. The family’s topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels the functional unit for the Kir channels is composed of four subunit that can assembly as either homo or heterotetramers. Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis. Kir3.1 is a member of the Kir3.x subfamily that includes four members (Kir3.1- Kir3.4). The Kir3 family is characterized by the fact that the channels can be activated by neurotransmitters and other factors acting via the activation of G-protein coupled receptors. Binding of the corresponding ligand to the G-protein receptor induces the dissociation of Gα-GTP from the Gβγ dimer. The latter directly binds to Kir3 and activates the channel.1,3 In the heart, Kir3.1 co-assembles with Kir3.4 to form the prototypical muscarinic-gated K+ channel KAch current, responsible for slowing the heart rate in response of parasympathetic stimulation.2 In the brain, Kir3.1 co-assembles with Kir3.2 and mediates the inhibitory effects of many neurotransmitters including opioid, adrenergic, muscarinic, dopaminergic and γ-aminobutyric acid (GABA).1,3 A peptide toxin originating from the Apis mellifera bee venom, Tertiapin (#STT-250) was shown to be a potent blocker of Kir3.1 containing channels (8.6 nM for the Kir3.1/3.4 combination and 5.4 nM for the Kir3.1/3.2).4,5

Form

Affinity purified antibody, Liquid

Storage & Stability

Store at +4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Applications

WB, IHC

Dilution

WB~~1:200-1:2000

Synonyms

G protein-activated inward rectifier potassium channel 1, GIRK-1, Inward rectifier K(+) channel Kir31, Potassium channel, inwardly rectifying subfamily J member 3, Kcnj3, Girk1

Images

Western blot analysis of rat brain membranes: 1. Anti-Kir3.1 (GIRK1) antibody ( AMM06205G), (1:200). 2. Anti-Kir3.1 (GIRK1) antibody, preincubated with the control antigen.

Specification

Quantity

Related Products

Select Brand Catalog No. Product Name Pack Size Type Field of Research Specification Quantity Price(USD)
1 Leading Biology APR03440G ITGA11 Antibody (N-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
2 Leading Biology APR04537G CMIP Antibody (C-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
3 Leading Biology APR13816G TRPM5 Antibody 50 μl Polyclonal Antibodies
$695.00 Add Ask
4 Leading Biology APR04506G PCOLCE2 Antibody (Center) 100 μl Polyclonal Antibodies
$495.00 Add Ask
5 Leading Biology APR12422G Human H4 Histamine Receptor (extracellular) Antibody 50 μl Polyclonal Antibodies
$695.00 Add Ask
6 Leading Biology APR26894N ASPH Polyclonal Antibody 100ul Polyclonal Antibodies Neuroscience>Calcium Signaling
$495.00 Add Ask

This item has successfully been added to your cart!

You have 0 item in your cart

Your inquiry has successfully been added to your list!

You have 0 item in your inquiry list