> Antigen, Antibodies, ELISA, Western Blot > Primary Antibody > Polyclonal Antibodies > M2 Muscarinic Receptor AntibodyBrand |
Leading Biology | Catalog Number |
APR12489G |
Product Type |
Polyclonal Antibodies | Field of Research |
|
Product Overview |
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format.
We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team.
This product is a high quality M2 Muscarinic Receptor antibody.
|
||
Molecular Weight |
51715 Da
|
||
Host |
Rabbit
|
||
Species Reactivity |
Human, Mouse, Rat
|
||
Target |
GST fusion protein with a sequence VANQDPVSPSLVQGRIVKPN NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSV SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid?residues 225-356 of human m2 (Accession P08172). 3rd intracellular loop.
|
||
GeneID |
|||
UniProt ID |
|||
Summary |
The action of the neurotransmitter acetylcholine is mediated through two types of receptors, the ionotrophic nicotinic receptors and the metabotrophic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-TM G-protein-coupled receptors. Five subtypes of muscarinic receptors have been cloned and are named m1-m5.1-2The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exerts both excitatory and inhibitory control over central and peripheral tissues.1-2Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control.1 They also participate in learning and memory processing.3-4The m2 receptor is considered to be the predominant muscarinic receptor that is expressed in cardiac muscle.5The m2 and m4 receptors mediate Ca2+ channel inhibition and Kir3 K+ channel activation by directly binding the Gbg subunit to the channel.6,7 Stimulation of the m2 receptor by acetylcholine in the heart results in activation of the Kir3.1/Kir3.4 channels causing a slowing in heart beat.7 Abgent is pleased to offer a highly specific antibody directed against the 3rd intracellular loop of the human m2 receptor. Anti-M2 Muscarinic Receptor antibody (#AG1218) can be used in western blot analysis, immunoprecipitation, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize m1 from mouse and rat and human samples.
|
||
Form |
Affinity purified antibody, Liquid |
||
Storage & Stability |
Store at +4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
|
||
Applications |
WB, IHC, IP, ICC
|
||
Dilution |
WB~~1:200-1:2000
IHC~~1:100
|
||
Synonyms |
Muscarinic acetylcholine receptor M2, CHRM2
|
||
Images |
Western blot analysis of rat brain membranes: 1. Anti-M2 Muscarinic Receptor antibody ( APR12489G), (1:200). 2. Anti-M2 Muscarinic Receptor antibody, preincubated with the control fusion protein antigen.
Expression of M2 Muscarinic Receptor in mouse parieto-temporal cortex sections Immunohistochemical staining of mouse parieto-temporal cortex frozen sections (non-consecutive) using Anti-Kir3.2 (GIRK2) antibody ( APC-006), (1:100) and Anti-M2 Muscarinic Receptor antibody ( APR12489G), (1:100). M2 Muscarinic Receptor staining (red) was dense in layer IV, with fibers climbing to layers II-III. Kir3.2 K+ channel staining (green) was dense in layers IV and I. Overlapping expression of Kir3.2 channel and M2 muscarinic Receptor is seen in cortical layers. |
||
Specification |
|||
Quantity |
|
||
| Select | Brand | Catalog No. | Product Name | Pack Size | Type | Field of Research | Specification | Quantity | Price(USD) | |
| 1 | Leading Biology | APR03440G | ITGA11 Antibody (N-term) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask | ||
| 2 | Leading Biology | APR04537G | CMIP Antibody (C-term) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask | ||
| 3 | Leading Biology | APR12422G | Human H4 Histamine Receptor (extracellular) Antibody | 50 μl | Polyclonal Antibodies |
|
$695.00 | Add Ask | ||
| 4 | Leading Biology | APR03844G | UBE2W Antibody (C-term) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask | ||
| 5 | Leading Biology | APR04349G | HECTD2 Antibody (N-term) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask | ||
| 6 | Leading Biology | APR03502G | IGHG1 Antibody (Center) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask |
Leading Biology Inc.
2600 Hilltop DR, Building G, B Suite C138
Richmond, CA, 94806
Tel: 1-661-524(LBI)-0262
Email: info@leadingbiology.com
Complete this form and click send to ask us a question, request a quote or simply say hello.

You have 0 item in your cart

You have 0 item in your inquiry list