• Account
  • Account
    Inquiries
    0

    Inquired items

    0 items total Subtotal:$ 0
  • 会员中心
    Cart

    Added items

    0items total Subtotal:$ 0

All Departments

KV1.3 Antibody

Catalog # Availability Size / Price Inquiry
APR17147G 50 μl / $695

KV1.3 Antibody

Brand

Leading Biology

Catalog Number

APR17147G

Product Type

Polyclonal Antibodies

Field of Research

Product Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KV1.3 antibody.

Molecular Weight

63842 Da

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Target

GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3 (Accession P22001). Intracellular, C-terminus.

GeneID

UniProt ID

Summary

KV1.3 belongs to theShakerfamily of voltage-dependent K+channels.The channel is widely expressed in the brain, lung and osteoclasts and in several cellpopulations of hematopoietic origin. It is in these cells (particularly T lymphocytes) thatKV1.3 function has centered a lot of attention. It was found that KV1.3 is the main channelResponsible for maintaining the resting potential in quiescent cells and regulating theCa2+signaling that is indispensable for normal T lymphocyte activation.1,2Based on the central role of Kv1.3 in regulating the initiation of an immune response,the channel has been recognized as a potential target for immunosuppressant drugs.1KV1.3 channels are potently inhibited by several venomous peptide toxins among themCharybdotoxin(#STC-325, 2.6 nM),Noxiustoxin(#STN-340, 1 nM),Kaliotoxin(#STK-370, 0.65 nM),Margatoxin(#STM-325, 0.05 nM),Agitoxin-1(#RTA-150, 1.7 nM),Agitoxin-2(#RTA-420, 0.004 nM),Hongotoxin-1(#RTH-400, 0.09 nM) andStichodactyla toxin(#RTS-400, 0.01 nM).3-7

Form

Affinity purified antibody, Liquid

Storage & Stability

Store at +4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Applications

WB, IP

Dilution

WB~~1:200-1:2000

Synonyms

Potassium voltage-gated channel subfamily A member 3, HGK5, HLK3, HPCN3, Voltage-gated K(+) channel HuKIII, Voltage-gated potassium channel subunit Kv13, KCNA3, HGK5

Images

Western blot analysis of rat brain membranes: 1. Anti-K 1.3 antibody ( APR17147G), (1:200) 2. Anti-K 1.3 antibody, preincubated with the control peptide antigen.

Specification

Quantity

Related Products

Select Brand Catalog No. Product Name Pack Size Type Field of Research Specification Quantity Price(USD)
1 Leading Biology APR03440G ITGA11 Antibody (N-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
2 Leading Biology APR04537G CMIP Antibody (C-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
3 Leading Biology APR12422G Human H4 Histamine Receptor (extracellular) Antibody 50 μl Polyclonal Antibodies
$695.00 Add Ask
4 Leading Biology APR03844G UBE2W Antibody (C-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
5 Leading Biology APR04349G HECTD2 Antibody (N-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
6 Leading Biology APR03502G IGHG1 Antibody (Center) 100 μl Polyclonal Antibodies
$495.00 Add Ask

Contact Us

This item has successfully been added to your cart!

You have 0 item in your cart

Your inquiry has successfully been added to your list!

You have 0 item in your inquiry list