> Antigen, Antibodies, ELISA, Western Blot > Primary Antibody > Polyclonal Antibodies > BMPR1A AntibodyBrand |
Leading Biology | Catalog Number |
APR0017G |
Product Type |
Polyclonal Antibodies | Field of Research |
|
Host |
Rabbit
|
||
Species Reactivity |
Human,Mouse,Rat
|
||
Immunogen |
Human BMPR1A
Homo sapiens (Human)
FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMG
KWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTR
ALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRY
MAPEVLDESLNKNHFQPYIM
174-427aa
|
||
Isotype |
IgG
|
||
Purification |
Antigen Affinity Purified
|
||
Form |
Liquid |
||
Storage & Stability |
Upon receipt, store at -20°C or -80°C. Avoid repeated freeze.
|
||
Storage Buffer |
PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20℃, Avoid freeze / thaw cycles.
|
||
Applications |
ELISA,WB
|
||
Images |
|
||
Quantity |
|
||
| Select | Brand | Catalog No. | Product Name | Pack Size | Type | Field of Research | Specification | Quantity | Price(USD) | |
| 1 | Leading Biology | APR03440G | ITGA11 Antibody (N-term) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask | ||
| 2 | Leading Biology | APR04537G | CMIP Antibody (C-term) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask | ||
| 3 | Leading Biology | APR12422G | Human H4 Histamine Receptor (extracellular) Antibody | 50 μl | Polyclonal Antibodies |
|
$695.00 | Add Ask | ||
| 4 | Leading Biology | APR03844G | UBE2W Antibody (C-term) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask | ||
| 5 | Leading Biology | APR04349G | HECTD2 Antibody (N-term) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask | ||
| 6 | Leading Biology | APR03502G | IGHG1 Antibody (Center) | 100 μl | Polyclonal Antibodies |
|
$495.00 | Add Ask |
Leading Biology Inc.
2600 Hilltop DR, Building G, B Suite C138
Richmond, CA, 94806
Tel: 1-661-524(LBI)-0262
Email: info@leadingbiology.com
You have 0 item in your cart
You have 0 item in your inquiry list
