We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KV1.1 antibody.

56409 Da

Rabbit

Human, Mouse, Rat

GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse Kv1.1 (Accession P16388), (MW: 36 kDa.).????Intracellular, C-terminus.

KV1.1 is a mammalian voltage dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.1 was the first mammalian KV channel to be cloned from mouse brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.1 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. 2The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in retina and pancreas.2 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle. Mutations in the coding of KV1.1 gene were discovered in Episodic Ataxia patients.3KV1.1 channels are sensitive to low doses of TEA (0.3 mM) and 4-AP (0.29 mM), the “classical” non-selective potassium channel blockers.Several venomous toxins from Snakes, Scorpions and Sea anemones are potent blockers (affecting the channels in the nanomolar range) of KV1.1 channels. Among these the most potent and selective are α-Dendrotoxin (#D-350, 0.4-4 nM) and δ-Dendrotoxin (#D-380, 0.03-1.8 nM), Dendrotoxin-K (#D-400, 0.03 nM), Agitoxin-2 (#RTA-420, 0.044 nM) and Hongotoxin-1 (#RTH-400, 0.031 nM).4

Affinity purified antibody, Liquid

Store at +4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

WB, IP

WB~~1:200-1:2000

Potassium voltage-gated channel subfamily A member 1, MBK1, MKI, Voltage-gated potassium channel subunit Kv11, Kcna1

Product Datasheet Protocol