• Account
  • Account
    Inquiries
    0

    Inquired items

    0 items total Subtotal:$ 0
  • 会员中心
    Cart

    Added items

    0items total Subtotal:$ 0

All Departments

hKV11.1 (HERG) Antibody

Catalog # Availability Size / Price Inquiry
APR12387G 50 μl / $695

hKV11.1 (HERG) Antibody

Brand

Leading Biology

Catalog Number

APR12387G

Product Type

Polyclonal Antibodies

Field of Research

Product Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality hKV11.1 (HERG) antibody.

Molecular Weight

126655 Da

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Target

GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human??Kv11.1 (HERG) (Accession Q12809), (MW: 35 kDa.). Intracellular, C-terminus.The antibody recognizes the HERG1b splice variant but not splice variants HERG1-3 and HERG-4

GeneID

UniProt ID

Summary

The KV11.1 (HERG) channel is a member of theether-a-go-go(EAG) subfamily of voltage-dependent K+channels that includes the related proteins KV11.2 and KV11.3 (erg2 and erg3). KV11.1 possess the signature structure of the voltage-dependent K+channels: six membrane-spanning domains and intracellular N and C termini.The KV11.1 current is characterized by strong inward rectification with slow activation and very rapid inactivation kinetics. The channel is expressed in the brain and heart (where it underlies theIKrcurrent) and has a central role in mediating repolarization of action potentials.1,2Mutations in the KV11.1 channel cause inherited long QT syndrome (LQTS) or abnormalities in the repolarization of the heart that are associated with life-threatening arrhythmias and sudden death. All the identified KV11.1 mutations produce loss of function of the channel via several cellular mechanisms ranging from alterations of gating properties, alterations of channel permeability/selectivity and alterations in intracellular channel trafficking that decreases the number of channels that reach the cell membrane.1,2Lately drug-induced forms of LQTS have been reported for a wide range of non-cardiac drugs including antihistamines, psychoactive agents and antimicrobials. All these drugs potently block the KV11.1 channel as an unintended side effect, prompting regulatory drug agencies to issue recommendations for the testing of new drugs for their potential KV11.1 blocking effect.In addition, KV11.1 expression was found to be upregulated in several tumor cell lines of different histogenesis suggesting that it confers the cells some advantage in cell proliferation. Indeed, in several studies it has been shown that inhibition of the KV11.1 current leads to a decrease in tumor cell proliferation.3Several toxins from scorpion venomsare potent blockers (affecting the channels in the nanomolar range) of KV11.1channels. Among these the most potent and selective areErgtoxin-1(#RTE-450), (16 nM)4andBeKM-1(#RTB-470), (3 nM).5In addition, themethanesulfonanilide class III antiarrhythmic agentE-4031(#E-500), also blocks KV11.1 channel in the nanomolar range (7.7 nM).6

Form

Affinity purified antibody, Liquid

Storage & Stability

Store at +4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Applications

WB, IP

Dilution

WB~~1:200-1:2000

Synonyms

Potassium voltage-gated channel subfamily H member 2, Eag homolog, Ether-a-go-go-related gene potassium channel 1, ERG-1, Eag-related protein 1, Ether-a-go-go-related protein 1, H-ERG, hERG-1, hERG1, Voltage-gated potassium channel subunit Kv111, KCNH2, ERG, ERG1, HERG

Images

Western blot analysis of K 11.1 expressing HEK-293 cells: 1. Anti-hK 11.1 (HERG) antibody ( APR12387G), (1:400). 2. Anti-hK 11.1 (HERG) antibody, preincubated with the control peptide antigen.

Immunoprecipitation of K 11.1 expressing HEK-293 cells: 1. Cell lysate. 2. Lysate + protein A beads + Anti- hK 11.1 (HERG) antibody ( APR12387G). 3. Cell lysate + protein A beads + Anti-K 11.1 (erg1) antibody ( APC-016). 4. Cell lysate + protein A beads + Anti-K 11.1 (HERG) (extracellular) antibody ( APC-109). 5. Cell lysate + protein A beads + pre-immune rabbit serum. Red arrow indicates K 11.1 while the black arrow shows the IgG heavy chain. Immunoblot was performed with the Anti- hK 11.1 (HERG) antibody.

Expression of K 11.1 in HEK-293 transfected cells Immunocytochemical staining of fixed and permeabilized Kv11.1 transfected HEK-293 cells. Cells were stained with Anti-hK 11.1 (HERG) antibody ( APR12387G), followed by goat anti-rabbit-AlexaFluor-555 secondary antibody (Red). Almost all transfected cells are stained positive for the K 11.1. Arrows indicate cells that do not express the channel.

Specification

Quantity

Related Products

Select Brand Catalog No. Product Name Pack Size Type Field of Research Specification Quantity Price(USD)
1 Leading Biology APR03440G ITGA11 Antibody (N-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
2 Leading Biology APR04537G CMIP Antibody (C-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
3 Leading Biology APR12422G Human H4 Histamine Receptor (extracellular) Antibody 50 μl Polyclonal Antibodies
$695.00 Add Ask
4 Leading Biology APR03844G UBE2W Antibody (C-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
5 Leading Biology APR04349G HECTD2 Antibody (N-term) 100 μl Polyclonal Antibodies
$495.00 Add Ask
6 Leading Biology APR03502G IGHG1 Antibody (Center) 100 μl Polyclonal Antibodies
$495.00 Add Ask

This item has successfully been added to your cart!

You have 0 item in your cart

Your inquiry has successfully been added to your list!

You have 0 item in your inquiry list