> Proteins, Peptides & Amino Acids > Recombinant Protein > MMP2 (Human) Recombinant ProteinBrand |
Leading Biology | Catalog Number |
PH0002 |
Product Type |
Recombinant Protein | Field of Research |
|
Product Overview |
Human MMP2 (P08253) partial recombinant protein expressed in Escherichia coli.
|
||
AA Sequence |
MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
|
||
Molecular Weight |
62.0
|
||
Activity |
MMP-2 activity was measured by its ability to cleave a chromogenic peptide MMP-2 substrate at room temperature. At an MMP-2 concentration of 2.5 ug/ml, 50% cleavage was achieved at an incubation time of approximately 25 minutes.
|
||
Endotoxin |
Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
|
||
Host |
Escherichia coli
|
||
Species Reactivity |
Human
|
||
Form |
Lyophlized |
||
Purity |
90% |
||
Storage & Stability |
Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, it is recommended to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
|
||
Storage Buffer |
Lyophilized from 0.4x PBS, pH 7.4.
|
||
Images |
|
||
Quantity |
|
||
| Select | Brand | Catalog No. | Product Name | Pack Size | Type | Field of Research | Specification | Quantity | Price(USD) | |
| 1 | Leading Biology | PH0009E2 | Recombinant Human STING Protein | Recombinant Protein |
|
$695.00 | Add Ask | |||
| 2 | Leading Biology | PH0164E1 | SARS-CoV-2 Nucleoprotein | 10ug | Recombinant Protein |
|
$99.00 | Add Ask | ||
| 3 | Leading Biology | PH0167M1 | SARS-CoV-2 Spike (541) Protein | 20ug | Recombinant Protein |
|
$99.00 | Add Ask | ||
| 4 | Leading Biology | PH0167E1 | SARS-CoV-2 RBD Protein | 10ug | Recombinant Protein |
|
$99.00 | Add Ask | ||
| 5 | Leading Biology | PH0005E1 | Recombinant Human FGL1 Protein | 10ug | Recombinant Protein |
|
$195.00 | Add Ask | ||
| 6 | Leading Biology | PH0168M1 | SARS-CoV-2 RBD (L452R, E484Q) Protein (His Tag) | 100μg | Recombinant Protein |
|
$495.00 | Add Ask |
Leading Biology Inc.
2600 Hilltop DR, Building G, B Suite C138
Richmond, CA, 94806
Tel: 1-661-524(LBI)-0262
Email: info@leadingbiology.com
You have 0 item in your cart
You have 0 item in your inquiry list
