Brand |
Leading Biology | Catalog Number |
PC0001M5 |
Product Type |
Recombinant Protein | Field of Research |
pneumonia virus |
Protein Length |
121 aa
|
||
Expression Host |
E.coli
|
||
Species |
coronavirus
|
||
AA Sequence |
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVS
PKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
|
||
GeneID |
|||
Protein Refseq |
|||
Disease |
pneumonia |
||
Form |
Lyophilized powder |
||
Purity |
>85% |
||
Storage & Stability |
Store at +4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
|
||
References |
1. A novel coronavirus associated with a respiratory disease in Wuhan of Hubei province, China (JOURNAL Unpublished)
2. Direct Submission (JOURNAL Submitted (05-JAN-2024) Shanghai Public Health Clinical Center & School of Public Health, Fudan University, Shanghai, China)
|
||
Images |
|
||
Quantity |
|
||
| Select | Brand | Catalog No. | Product Name | Pack Size | Type | Field of Research | Specification | Quantity | Price(USD) | |
| 1 | Leading Biology | PH0009E2 | Recombinant Human STING Protein | Recombinant Protein |
|
$695.00 | Add Ask | |||
| 2 | Leading Biology | PH0164E1 | SARS-CoV-2 Nucleoprotein | 10ug | Recombinant Protein |
|
$99.00 | Add Ask | ||
| 3 | Leading Biology | PH0167M1 | SARS-CoV-2 Spike (541) Protein | 20ug | Recombinant Protein |
|
$99.00 | Add Ask | ||
| 4 | Leading Biology | PH0167E1 | SARS-CoV-2 RBD Protein | 10ug | Recombinant Protein |
|
$99.00 | Add Ask | ||
| 5 | Leading Biology | PH0005E1 | Recombinant Human FGL1 Protein | 10ug | Recombinant Protein |
|
$195.00 | Add Ask | ||
| 6 | Leading Biology | PH0168M1 | SARS-CoV-2 RBD (L452R, E484Q) Protein (His Tag) | 100μg | Recombinant Protein |
|
$495.00 | Add Ask |
Leading Biology Inc.
2600 Hilltop DR, Building G, B Suite C138
Richmond, CA, 94806
Tel: 1-661-524(LBI)-0262
Email: info@leadingbiology.com
Complete this form and click send to ask us a question, request a quote or simply say hello.

You have 0 item in your cart

You have 0 item in your inquiry list